PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g46910.1.p
Common NameBRADI_3g46910, LOC100841244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 318aa    MW: 34143.4 Da    PI: 7.8257
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g46910.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.9e-181562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+  ++q+G g+W++ +++ g++R++k+c++rw +yl
  Bradi3g46910.1.p 15 KGPWTPEEDQKLLSHIEQHGHGCWRSLPAKAGLRRCGKSCRLRWTNYL 62
                      79********************************************97 PP

2Myb_DNA-binding53.65.3e-1768113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Bradi3g46910.1.p  68 RGKFTLQEEQSIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 113
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-25765IPR009057Homeodomain-like
PROSITE profilePS5129417.7741062IPR017930Myb domain
SuperFamilySSF466899.73E-3012109IPR009057Homeodomain-like
SMARTSM007176.5E-151464IPR001005SANT/Myb domain
PfamPF002492.5E-161562IPR001005SANT/Myb domain
CDDcd001676.41E-121762No hitNo description
PROSITE profilePS5129425.70763117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2666117IPR009057Homeodomain-like
SMARTSM007172.6E-1667115IPR001005SANT/Myb domain
PfamPF002493.8E-1668113IPR001005SANT/Myb domain
CDDcd001679.21E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRSPCCEKE AGLKKGPWTP EEDQKLLSHI EQHGHGCWRS LPAKAGLRRC GKSCRLRWTN  60
YLRPDIKRGK FTLQEEQSII QLHALLGNRW SAIATHLPKR TDNEIKNYWN THLKKRLAKM  120
GIDPVTHKPR ADADAGSGTG ARSRVAAHLS HTAQWESARL EAEARLAREA KLRALASPQP  180
APASAASVLD SPTSTLSFSE SALFGAGAAR TPVQPVQSYG DACEEQQRFG GGGGETGFAG  240
SGITFASVLL DCSVAAGTEQ RLLKMAEDEV GELEDKGYWS SILNMVNSSM SSSLTSEVAA  300
DDPEMYLPAA AAAAGEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27131175108B-MYB
1h8a_C3e-271311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0853911e-173BT085391.2 Zea mays full-length cDNA clone ZM_BFc0006G19 mRNA, complete cds.
GenBankBT0863811e-173BT086381.2 Zea mays full-length cDNA clone ZM_BFc0159P01 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572652.10.0PREDICTED: myb-related protein Zm38-like
TrEMBLI1IAW90.0I1IAW9_BRADI; Uncharacterized protein
STRINGBRADI3G46910.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56093758
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.19e-90myb domain protein 16